Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGLYRP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-196 of human PGLYRP1 (NP_005082.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PGLYRP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-196 of human PGLYRP1 (NP_005082.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06428A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGLYRP1 |
| Target Synonyms | PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L; PGLYRP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-196 of human PGLYRP1 (NP_005082.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP | Uniprot ID | O75594 |
Uniprot Id
O75594
Target Species
Human
Target Name
PGLYRP1
Target Full Name
Peptidoglycan recognition protein 1
Target Function
Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity. Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane. In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement. Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system. Promotes also the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their target-cell specificity. Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor.
Target Subcellular Location
Secreted. Cytoplasmic granule.
Target Protein Families
N-acetylmuramoyl-L-alanine amidase 2 family
Target Tissue Specificity
Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils.
Target Research Area
Cancer
Target Synonyms
MGC126894; MGC126896; Peptidoglycan recognition protein 1; Peptidoglycan recognition protein; Peptidoglycan recognition protein short; PGLYRP; PGLYRP1; PGRP; PGRP S; PGRP-S; PGRP1_HUMAN; PHRP, short; SBBI68; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); TNFSF 3L; TNFSF3L; UNQ639/PRO1269
Target Background
Enables peptidoglycan binding activity and peptidoglycan immune receptor activity. Involved in antimicrobial humoral immune response mediated by antimicrobial peptide; killing of cells of other organism; and response to bacterium. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
