Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHPT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PHPT1 (NP_054891.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHPT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PHPT1 (NP_054891.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHPT1 |
| Target Synonyms | PHP; PHP14; CGI-202; HSPC141; HEL-S-132P; PHPT1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, MCF7, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PHPT1 (NP_054891.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY | Uniprot ID | Q9NRX4 |
Uniprot Id
Q9NRX4
Target Species
Human
Target Name
PHPT1
Target Full Name
14 kDa phosphohistidine phosphatase
Target Function
Exhibits phosphohistidine phosphatase activity.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Janus family
Target Tissue Specificity
Expressed abundantly in heart and skeletal muscle.
Target Research Area
Cell Biology
Target Synonyms
14 kDa phosphohistidine phosphatase; CGI 202; HSPC141; Phosphohistidine phosphatase 1; PHP14; PHP14_HUMAN; PHPT1; Protein janus A homolog; Protein janus-A homolog; Sex regulated protein janus a
Target Background
This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
