Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIK3R4/VPS15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4/VPS15 (Q99570) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PIK3R4/VPS15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4/VPS15 (Q99570) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14326A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIK3R4/VPS15 |
| Target Synonyms | p150; VPS15; PIK3R4/VPS15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse lung, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4/VPS15 (Q99570). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK | Uniprot ID | Q99570 |
Uniprot Id
Q99570
Target Species
Human
Target Name
PIK3R4
Target Full Name
Phosphoinositide 3-kinase regulatory subunit 4
Target Function
Regulatory subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and cytokinesis, probably in the context of PI3KC3-C2.
Target Subcellular Location
Late endosome. Cytoplasmic vesicle, autophagosome. Membrane; Lipid-anchor.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
MGC102700; P150; Phosphatidylinositol 3 kinase associated p150; Phosphatidylinositol 3 kinase regulatory subunit polypeptide 4; Phosphatidylinositol 3 kinase regulatory subunit polypeptide 4 p150; Phosphoinositide 3 kinase adaptor protein; Phosphoinositide 3 kinase regulatory subunit 4; Phosphoinositide 3 kinase regulatory subunit 4 p150; Phosphoinositide 3 kinase regulatory subunit polypeptide 4; Phosphoinositide 3 kinase regulatory subunit polypeptide 4 p150; Phosphoinositide 3-kinase adaptor protein; Phosphoinositide 3-kinase regulatory subunit 4; PI3 kinase p150 subunit; PI3-kinase p150 subunit; PI3-kinase regulatory subunit 4; PI3R4_HUMAN; PIK3R 4; PIK3R4; VPS 15; VPS15
Target Background
Predicted to enable protein serine/threonine kinase activity. Involved in positive regulation of phosphatidylinositol 3-kinase activity; receptor catabolic process; and regulation of cytokinesis. Located in late endosome and microtubule cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
