Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIMREG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIMREG (NP_001182157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIMREG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIMREG (NP_001182157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIMREG |
| Target Synonyms | CATS; RCS1; FAM64A; PIMREG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse ovary, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PIMREG (NP_001182157.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRI | Uniprot ID | Q9BSJ6 |
Uniprot Id
Q9BSJ6
Target Species
Human
Target Name
PIMREG
Target Full Name
Protein PIMREG
Target Function
During mitosis, may play a role in the control of metaphase-to-anaphase transition.
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Tissue Specificity
Expressed in thymus (at protein level). Detected in spleen, colon, ovary and small intestines.
Target Synonyms
FA64A_HUMAN; FAM64A; family with sequence similarity 64; member A; FLJ10156; FLJ10491; Protein FAM64A; RCS1; regulator of chromosome segregation 1
Target Background
Predicted to be involved in cell division. Located in nucleolus and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
