-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIN4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07210A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIN4 |
| Target Synonyms | EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17; PIN4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HepG2, Mouse brain, Mouse liver, Rat testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK | Uniprot ID | Q9Y237 |
Uniprot Id
Q9Y237
Target Species
Human
Target Name
PIN4
Target Full Name
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
Target Function
Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.; Isoform 2 binds to double-stranded DNA.
Target Subcellular Location
[Isoform 1]: Nucleus, nucleolus. Cytoplasm, cytoskeleton, spindle. Cytoplasm. Note=Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1.; [Isoform 2]: Mitochondrion. Mitochondrion matrix. Note=Imported in a time- and membrane potential-dependent manner to the mitochondrial matrix, but without concomitant processing of the protein. Directed to mitochondria by a novel N-terminal domain that functions as non-cleavable mitochondrial targeting peptide.
Target Protein Families
PpiC/parvulin rotamase family, PIN4 subfamily
Target Tissue Specificity
Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much m
Target Synonyms
EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17; PIN4
Target Background
This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.
Notification