-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLA2G16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLA2G16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10019A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLA2G16 |
| Target Synonyms | AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ | Uniprot ID | P53816 |
Uniprot Id
P53816
Target Species
Human
Target Name
PLAAT3
Target Full Name
Phospholipase A and acyltransferase 3
Target Function
Exhibits both phospholipase A1/2 and acyltransferase activities. Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids. For most substrates, PLA1 activity is much higher than PLA2 activity. Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid. Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity. Required for complete organelle rupture and degradation that occur during eye lens terminal differentiation, when fiber cells that compose the lens degrade all membrane-bound organelles in order to provide lens with transparency to allow the passage of light. Organelle membrane degradation is probably catalyzed by the phospholipase activity.; (Microbial infection) Acts as a host factor for picornaviruses: required during early infection to promote viral genome release into the cytoplasm. May act as a cellular sensor of membrane damage at sites of virus entry, which relocalizes to sites of membrane rupture upon virus unfection. Facilitates safe passage of the RNA away from LGALS8, enabling viral genome translation by host ribosome. May also be involved in initiating pore formation, increasing pore size or in maintaining pores for genome delivery. The lipid-modifying enzyme activity is required for this process.
Target Subcellular Location
Cell membrane; Single-pass membrane protein. Cytoplasm. Cytoplasm, cytosol. Cytoplasm, perinuclear region. Peroxisome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Nucleus envelope. Lysosome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
H-rev107 family
Target Tissue Specificity
Widely expressed. low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down-regulated in some ovarian carcinomas and testicular germ cell tumors. Highly expressed
Target Synonyms
PLAAT3; HRASLS3; HREV107; PLA2G16; Phospholipase A and acyltransferase 3; Adipose-specific phospholipase A2; AdPLA; Group XVI phospholipase A1/A2; H-rev 107 protein homolog; H-REV107; HREV107-1; HRAS-like suppressor 1; HRAS-like suppressor 3; HRSL3; HREV107-3; Renal carcinoma antigen NY-REN-65
Target Background
Enables N-acyltransferase activity; phospholipase A1 activity; and phospholipase A2 activity. Involved in N-acylphosphatidylethanolamine metabolic process. Predicted to be located in several cellular components, including lysosome; nuclear envelope; and peroxisome. Predicted to be active in cytoplasm. Biomarker of seminoma.
Notification