-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLA2G6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human PLA2G6 (NP_003551.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLA2G6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human PLA2G6 (NP_003551.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00974A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLA2G6 |
| Target Synonyms | GVI; PLA2; INAD1; NBIA2; iPLA2; NBIA2A; NBIA2B; PARK14; PNPLA9; CaI-PLA2; IPLA2-VIA; iPLA2beta; PLA2G6 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human PLA2G6 (NP_003551.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG | Uniprot ID | O60733 |
Uniprot Id
O60733
Target Species
Human
Target Name
PLA2G6
Target Full Name
85/88 kDa calcium-independent phospholipase A2
Target Function
Calcium-independent phospholipase involved in phospholipid remodeling with implications in cellular membrane homeostasis, mitochondrial integrity and signal transduction. Hydrolyzes the ester bond of the fatty acyl group attached at sn-1 or sn-2 position of phospholipids (phospholipase A1 and A2 activity respectively), producing lysophospholipids that are used in deacylation-reacylation cycles. Hydrolyzes both saturated and unsaturated long fatty acyl chains in various glycerophospholipid classes such as phosphatidylcholines, phosphatidylethanolamines and phosphatidates, with a preference for hydrolysis at sn-2 position. Can further hydrolyze lysophospholipids carrying saturated fatty acyl chains (lysophospholipase activity). Upon oxidative stress, contributes to remodeling of mitochondrial phospholipids in pancreatic beta cells, in a repair mechanism to reduce oxidized lipid content. Preferentially hydrolyzes oxidized polyunsaturated fatty acyl chains from cardiolipins, yielding monolysocardiolipins that can be reacylated with unoxidized fatty acyls to regenerate native cardiolipin species. Hydrolyzes oxidized glycerophosphoethanolamines present in pancreatic islets, releasing oxidized polyunsaturated fatty acids such as hydroxyeicosatetraenoates (HETEs). Has thioesterase activity toward fatty-acyl CoA releasing CoA-SH known to facilitate fatty acid transport and beta-oxidation in mitochondria particularly in skeletal muscle. Plays a role in regulation of membrane dynamics and homeostasis. Selectively hydrolyzes sn-2 arachidonoyl group in plasmalogen phospholipids, structural components of lipid rafts and myelin. Regulates F-actin polymerization at the pseudopods, which is required for both speed and directionality of MCP1/CCL2-induced monocyte chemotaxis. Targets membrane phospholipids to produce potent lipid signaling messengers. Generates lysophosphatidate (LPA, 1-acyl-glycerol-3-phosphate), which acts via G-protein receptors in various cell types. Has phospholipase A2 activity toward platelet-activating factor (PAF, 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine), likely playing a role in inactivation of this potent proinflammatory signaling lipid. In response to glucose, amplifies calcium influx in pancreatic beta cells to promote INS secretion.; Lacks the catalytic domain and may act as a negative regulator of the catalytically active isoforms.; Lacks the catalytic domain and may act as a negative regulator of the catalytically active isoforms.
Target Involvement
Neurodegeneration with brain iron accumulation 2B (NBIA2B); Neurodegeneration with brain iron accumulation 2A (NBIA2A); Parkinson disease 14 (PARK14)
Target Subcellular Location
Cytoplasm. Cell membrane. Mitochondrion. Cell projection, pseudopodium.
Target Tissue Specificity
Four different transcripts were found to be expressed in a distinct tissue distribution.
Target Synonyms
85 kDa calcium independent phospholipase A2; 85/88 kDa calcium-independent phospholipase A2; BB112799; CaI PLA2; CaI-PLA2; CaIPLA2; Calcium independent phospholipase A2; CTA-228A.2; Cytosolic calcium independent phospholipase A2; EC 3.1.1.4; Group VI phospholipase A2; Group VI, A; GVI; GVI PLA2; INAD1; Intracellular membrane associated calcium independent phospholipase A2 beta; Intracellular membrane-associated calcium-independent phospholipase A2 beta; iPLA(2)beta; iPLA2 beta; iPLA2-beta; IPLA2-VIA; iPLA2beta; NBIA2; NBIA2A; NBIA2B; Neurodegeneration with brain iron accumulation 2; OTTHUMP00000199457; PARK14; Patatin like phospholipase domain containing 9; Patatin like phospholipase domain containing protein 9; Patatin-like phospholipase domain-containing protein 9; Phospholipase A2 calcium independent; Phospholipase A2 calcium independent group VI A; Phospholipase A2 group VI; Phospholipase A2 group VI cytosolic calcium independent; Phospholipase A2, group VI (cytosolic, calcium independent); PLA2; PLA2G6; PLPL9_HUMAN; PNPLA9
Target Background
The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Notification