-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PLK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09385A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLK2 |
| Target Synonyms | SNK; hSNK; hPlk2; PLK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, Jurkat, Mouse brain, Mouse lung, Rat liver, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 361-439 of human PLK2 (NP_006613.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQ | Uniprot ID | Q9NYY3 |
Uniprot Id
Q9NYY3
Target Species
Human
Target Name
PLK2
Target Full Name
Serine/threonine-protein kinase PLK2
Target Function
Tumor suppressor serine/threonine-protein kinase involved in synaptic plasticity, centriole duplication and G1/S phase transition. Polo-like kinases act by binding and phosphorylating proteins are that already phosphorylated on a specific motif recognized by the POLO box domains. Phosphorylates CENPJ, NPM1, RAPGEF2, RASGRF1, SNCA, SIPA1L1 and SYNGAP1. Plays a key role in synaptic plasticity and memory by regulating the Ras and Rap protein signaling: required for overactivity-dependent spine remodeling by phosphorylating the Ras activator RASGRF1 and the Rap inhibitor SIPA1L1 leading to their degradation by the proteasome. Conversely, phosphorylates the Rap activator RAPGEF2 and the Ras inhibitor SYNGAP1, promoting their activity. Also regulates synaptic plasticity independently of kinase activity, via its interaction with NSF that disrupts the interaction between NSF and the GRIA2 subunit of AMPARs, leading to a rapid rundown of AMPAR-mediated current that occludes long term depression. Required for procentriole formation and centriole duplication by phosphorylating CENPJ and NPM1, respectively. Its induction by p53/TP53 suggests that it may participate in the mitotic checkpoint following stress.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cell projection, dendrite. Note=Localizes to centrosomes during early G1 phase where it only associates to the mother centriole and then distributes equally to both mother and daughter centrioles at the onset of S phase.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, CDC5/Polo subfamily
Target Tissue Specificity
Expressed at higher level in the fetal lung, kidney, spleen and heart.
Target Synonyms
hPlk2; hSNK; PLK-2; Plk2; PLK2_HUMAN; Polo like kinase 2; Polo-like kinase 2; Serine/threonine protein kinase PLK2; Serine/threonine protein kinase SNK; Serine/threonine-protein kinase PLK2; Serine/threonine-protein kinase SNK; Serum Induced Kinase; Serum-inducible kinase; SNK
Target Background
The protein encoded by this gene is a member of the polo family of serine/threonine protein kinases that have a role in normal cell division. This gene is most abundantly expressed in testis, spleen and fetal tissues, and its expression is inducible by serum, suggesting that it may also play an important role in cells undergoing rapid cell division. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification