Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human PLS1 (NP_001165783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PLS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human PLS1 (NP_001165783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05154A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLS1 |
| Target Synonyms | DFNA76; PLS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, LO2, Mouse brain, Mouse liver, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human PLS1 (NP_001165783.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTST | Uniprot ID | Q14651 |
Uniprot Id
Q14651
Target Species
Human
Target Name
PLS1
Target Full Name
Plastin-1
Target Function
Actin-bundling protein. In the inner ear, it is required for stereocilia formation. Mediates liquid packing of actin filaments that is necessary for stereocilia to grow to their proper dimensions.
Target Subcellular Location
Cytoplasm. Cell projection, stereocilium.
Target Tissue Specificity
In small intestine, colon, and kidney; relatively lower levels of expression are detected in the lung and stomach.
Target Synonyms
PLS1; Plastin-1; Intestine-specific plastin; I-plastin
Target Background
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this gene is a third distinct plastin isoform, which is specifically expressed at high levels in the small intestine. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. A pseudogene of this gene is found on chromosome 11.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
