Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PNMA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PNMA2 (NP_009188.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PNMA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PNMA2 (NP_009188.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03950A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PNMA2 |
| Target Synonyms | MA2; MM2; RGAG2; PNMA2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human PNMA2 (NP_009188.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRLLGKIFRKQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPE | Uniprot ID | Q9UL42 |
Uniprot Id
Q9UL42
Target Species
Human
Target Name
PNMA2
Target Full Name
Paraneoplastic antigen Ma2
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
PNMA family
Target Tissue Specificity
Brain-specific. In some cancer patients, specifically expressed by testicular tumor cells.
Target Research Area
Tags & Cell Markers, Neuroscience
Target Synonyms
40 kDa neuronal protein; KIAA0883; MA2; MM2; Onconeuronal antigen Ma2; Paraneoplastic antigen Ma2; Paraneoplastic Ma antigen 2; Paraneoplastic neuronal antigen ; Paraneoplastic neuronal antigen MM2; PNMA2; PNMA2_HUMAN; Retrotransposon gag domain containing 2; RGAG2
Target Background
Predicted to be involved in positive regulation of apoptotic process. Predicted to be located in nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
