Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PODN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 67-210 of human PODN (NP_714914.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PODN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 67-210 of human PODN (NP_714914.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05730A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PODN |
| Target Synonyms | PCAN; SLRR5A; PODN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 67-210 of human PODN (NP_714914.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDCACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEKAFEHLTNLNYLYLANNKLTLAP | Uniprot ID | Q7Z5L7 |
Uniprot Id
Q7Z5L7
Target Species
Human
Target Name
PODN
Target Full Name
Podocan
Target Function
Negatively regulates cell proliferation and cell migration.
Target Subcellular Location
[Isoform 1]: Secreted, extracellular space, extracellular matrix.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 4]: Cytoplasm.
Target Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class V subfamily
Target Tissue Specificity
Kidney, heart, liver, pancreas and vascular smooth muscle cells. Also detected in aortic intima (at protein level).
Target Synonyms
9430070G18; LRRGT00160; MGC24995; PCAN; Podn; PODN_HUMAN; Podocan; Podocan proteoglycan; RP23 40G2.7; SLRR5A
Target Background
The protein encoded by this gene is a member of the small leucine-rich repeat protein family and contains an amino terminal CX3CXCX7C cysteine-rich cluster followed by a leucine-rich repeat domain. Studies suggest that this protein could function to inhibit smooth muscle cell proliferation and migration following arterial injury.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
