Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLDIP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human POLDIP2 (NP_056399.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLDIP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human POLDIP2 (NP_056399.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04819A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLDIP2 |
| Target Synonyms | p38; POLD4; PDIP38; POLDIP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, A-549, HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human POLDIP2 (NP_056399.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP | Uniprot ID | Q9Y2S7 |
Uniprot Id
Q9Y2S7
Target Species
Human
Target Name
POLDIP2
Target Full Name
Polymerase delta-interacting protein 2
Target Function
Involved in DNA damage tolerance by regulating translesion synthesis (TLS) of templates carrying DNA damage lesions such as 8oxoG and abasic sites. May act by stimulating activity of DNA polymerases involved in TLS, such as PRIMPOL and polymerase delta (POLD1).
Target Subcellular Location
Mitochondrion matrix. Nucleus.
Target Synonyms
38 kDa DNA polymerase delta interaction protein; delta interacting protein 2; DNA polymerase delta interaction protein p38; p38; PDIP 2; PDIP 38; PDIP2; PDIP2_HUMAN; PDIP38; POLD 4; POLD4; Poldip2; Polymerase (DNA directed) delta interacting protein 2; Polymerase delta interacting protein 38; Polymerase delta-interacting protein 2
Target Background
This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit, as well as with proliferating cell nuclear antigen. The encoded protein maybe play a role in the ability of the replication fork to bypass DNA lesions. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
