-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLRMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against POLRMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-11376A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLRMT |
| Target Synonyms | APOLMT; MTRNAP; MTRPOL; COXPD55; h-mtRPOL; POLRMT | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, HepG2 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF | Uniprot ID | O00411 |
Uniprot Id
O00411
Target Species
Human
Target Name
POLRMT
Target Full Name
DNA-directed RNA polymerase, mitochondrial
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of mitochondrial DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and POLRMT that is required for basal transcription of mitochondrial DNA. In this complex, TFAM recruits POLRMT to a specific promoter whereas TFB2M induces structural changes in POLRMT to enable promoter opening and trapping of the DNA non-template strand.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Phage and mitochondrial RNA polymerase family
Target Synonyms
APOLMT; DNA-directed RNA polymerase; DNA-directed RNA polymerase mitochondrial; h-mtRPOL; mitochondrial; MTRNAP; MtRPOL; POLRMT; polymerase (RNA) mitochondrial (DNA directed); polymerase, RNA, mitochondrial; RPOM; RPOM_HUMAN
Target Background
This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes.
Notification