-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POU2F2 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 400-479 of human POU2F2 (NP_001193954.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POU2F2 was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 400-479 of human POU2F2 (NP_001193954.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07648A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POU2F2 |
| Target Synonyms | OCT2; OTF2; Oct-2; POU2F2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Daudi, HepG2, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence within amino acids 400-479 of human POU2F2 (NP_001193954.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP | Uniprot ID | P09086 |
Uniprot Id
P09086
Target Species
Human
Target Name
POU2F2
Target Full Name
POU domain, class 2, transcription factor 2
Target Function
Transcription factor that specifically binds to the octamer motif (5'-ATTTGCAT-3'). Regulates IL6 expression in B cells with POU2AF1. Regulates transcription in a number of tissues in addition to activating immunoglobulin gene expression. Modulates transcription transactivation by NR3C1, AR and PGR.; Activates the U2 small nuclear RNA (snRNA) promoter.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
POU transcription factor family, Class-2 subfamily
Target Tissue Specificity
Isoform 3 is B-cell specific. Isoform 5 is expressed in B-cells and the immunoglobulin-expressing T-cell line MOLT-4, but not in the T-cell line BW5147.
Target Synonyms
class 2; Lymphoid restricted immunoglobulin octamer binding protein; Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2; NF A2; Oct 2; Oct-2; Octamer binding transcription factor 2; Octamer-binding protein 2; Octamer-binding transcription factor 2; OTF-2; OTF2; PO2F2_HUMAN; POU domain; POU domain class 2 transcription factor 2; POU2F2; transcription factor 2
Target Background
The protein encoded by this gene is a homeobox-containing transcription factor of the POU domain family. The encoded protein binds the octamer sequence 5'-ATTTGCAT-3', a common transcription factor binding site in immunoglobulin gene promoters. Several transcript variants encoding different isoforms have been found for this gene.
Notification