-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPHLN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 195-255 of human PPHLN1 (NP_958846.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPHLN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 195-255 of human PPHLN1 (NP_958846.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07034A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPHLN1 |
| Target Synonyms | CR; HSPC206; HSPC232; PPHLN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat lung, Rat spleen, Rat testis, THP-1, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 195-255 of human PPHLN1 (NP_958846.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQ | Uniprot ID | Q8NEY8 |
Uniprot Id
Q8NEY8
Target Species
Human
Target Name
PPHLN1
Target Full Name
Periphilin-1
Target Function
Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3. In the HUSH complex, contributes to the maintenance of the complex at chromatin. Acts as a transcriptional corepressor and regulates the cell cycle, probably via the HUSH complex. The HUSH complex is also involved in the silencing of unintegrated retroviral DNA: some part of the retroviral DNA formed immediately after infection remains unintegrated in the host genome and is transcriptionally repressed. May be involved in epithelial differentiation by contributing to epidermal integrity and barrier formation.
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Gastric cancer antigen Ga50; Periphilin 1; Periphilin-1; PPHLN_HUMAN; PPHLN1
Target Background
The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Notification