-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPIH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human PPIH (NP_006338.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPIH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human PPIH (NP_006338.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02219A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPIH |
| Target Synonyms | CYPH; CYP-20; USA-CYP; SnuCyp-20; PPIH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HepG2, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human PPIH (NP_006338.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM | Uniprot ID | O43447 |
Uniprot Id
O43447
Target Species
Human
Target Name
PPIH
Target Full Name
Peptidyl-prolyl cis-trans isomerase H
Target Function
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone.
Target Subcellular Location
Nucleus speckle. Cytoplasm. Note=Colocalizes with spliceosomal snRNPs. A small proportion may also be cytoplasmic.
Target Protein Families
Cyclophilin-type PPIase family, PPIase H subfamily
Target Synonyms
Cyclophilin H; CYP-20; CypH; Peptidyl prolyl cis trans isomerase H; Peptidyl-prolyl cis-trans isomerase H; Peptidylprolyl isomerase H; PPIase H; PPIH; PPIH_HUMAN; RGD1564921; Rotamase H; Small nuclear ribonucleoprotein particle specific cyclophilin H; Small nuclear ribonucleoprotein particle-specific cyclophilin H; SnuCyp 20; U snRNP associated cyclophilin SnuCyp 20; U-snRNP-associated cyclophilin SnuCyp-20; USA CYP; USA-CYP; USACYP
Target Background
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Notification