Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP3R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 11-170 of human PPP3R1 (NP_000936.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PPP3R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 11-170 of human PPP3R1 (NP_000936.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01135A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP3R1 |
| Target Synonyms | CNB; CNB1; CALNB1; PPP3R1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HL-60, MCF7, Mouse brain, Mouse lung, Mouse spleen, Rat testis, SH-SY5Y, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 11-170 of human PPP3R1 (NP_000936.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV | Uniprot ID | P63098 |
Uniprot Id
P63098
Target Species
Human
Target Name
PPP3R1
Target Full Name
Calcineurin subunit B type 1
Target Function
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
Target Subcellular Location
Cytoplasm, cytosol. Cell membrane. Cell membrane, sarcolemma. Cell membrane; Lipid-anchor.
Target Protein Families
Calcineurin regulatory subunit family
Target Synonyms
alpha isoform (calcineurin B; type I); calcineurin B; type I (19kDa); Calcineurin subunit B type 1; CALNB1; CANB1_HUMAN; Cna2; CNB; CNB1; OTTHUMP00000201960; OTTHUMP00000201961; Ppp3r1; PPP3R1 protein phosphatase 3 (formerly 2B); regulatory subunit B; alpha isoform; protein phosphatase3 (formerly2B); regulatory subunit B; alpha isoform; Protein phosphatase 2B regulatory subunit 1; Protein phosphatase 2B regulatory subunit B alpha; protein phosphatase 3 (formerly 2B); regulatory subunit B; 19kDa; alpha isoform (calcineurin B; type I); Protein phosphatase 3 (formerly 2B); regulatory subunit B (19kD); alpha isoform (calcineurin B; type I); Protein phosphatase 3 regulatory subunit B alpha; Protein phosphatase 3 regulatory subunit B alpha isoform 1
Target Background
Enables cyclosporin A binding activity; phosphatase binding activity; and protein domain specific binding activity. Involved in calcineurin-NFAT signaling cascade and positive regulation of transcription by RNA polymerase II. Part of calcineurin complex. Implicated in Alzheimer's disease and dilated cardiomyopathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
