Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPP3R2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human PPP3R2 (NP_671709.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPP3R2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human PPP3R2 (NP_671709.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02468A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPP3R2 |
| Target Synonyms | PPP3RL; PPP3R2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, H9C2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human PPP3R2 (NP_671709.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV | Uniprot ID | Q96LZ3 |
Uniprot Id
Q96LZ3
Target Species
Human
Target Name
PPP3R2
Target Full Name
Calcineurin subunit B type 2
Target Function
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
Target Protein Families
Calcineurin regulatory subunit family
Target Tissue Specificity
Testis-specific.
Target Research Area
Signal Transduction
Target Synonyms
Calcineurin B like protein; Calcineurin B type II (19kDa); Calcineurin B type II; Calcineurin B-like protein; Calcineurin BII; Calcineurin subunit B isoform 2; Calcineurin subunit B type 2; CANB2_HUMAN; CBLP; CBLP like; CNBII; PPP3R1-like; Ppp3r2; PPP3RL; Protein phosphatase 2B regulatory subunit 2; Protein phosphatase 3 (formerly 2B) regulatory subunit B (19kD) beta isoform (calcineurin B type II); Protein phosphatase 3 (formerly 2B) regulatory subunit B beta isoform; Protein phosphatase 3 (formerly 2B); regulatory subunit B; 19kDa; beta isoform (calcineurin B; type II); Protein phosphatase 3 regulatory subunit B (19kD) beta isoform (calcineurin B type II); Protein phosphatase 3 regulatory subunit B (calcineurin B) like; Protein phosphatase 3 regulatory subunit B beta; Protein phosphatase 3 regulatory subunit B beta isoform
Target Background
Predicted to enable calcium ion binding activity and calcium-dependent protein serine/threonine phosphatase regulator activity. Predicted to be involved in regulation of catalytic activity. Predicted to act upstream of or within penetration of zona pellucida. Predicted to be located in sperm mitochondrial sheath. Predicted to be part of calcineurin complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
