-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKCDBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRKCDBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02090A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKCDBP |
| Target Synonyms | SRBC; HSRBC; PRKCDBP; cavin-3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 75-160 of human PRKCDBP (NP_659477.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA | Uniprot ID | Q969G5 |
Uniprot Id
Q969G5
Target Species
Human
Target Name
CAVIN3
Target Full Name
Caveolae-associated protein 3
Target Function
Regulates the traffic and/or budding of caveolae. Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in smooth muscle but not in the lung and heart endothelial cells. Regulates the equilibrium between cell surface-associated and cell surface-dissociated caveolae by promoting the rapid release of caveolae from the cell surface. Plays a role in the regulation of the circadian clock. Modulates the period length and phase of circadian gene expression and also regulates expression and interaction of the core clock components PER1/2 and CRY1/2.
Target Subcellular Location
Cytoplasm. Membrane, caveola. Cytoplasm, cytosol.
Target Protein Families
CAVIN family
Target Tissue Specificity
Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Strongly expressed in mammary and epithelial cells.
Target Synonyms
Cavin 3; Cavin-3; CAVIN3; hSRBC; MGC20400; PRDBP_HUMAN; Prkcdbp; Protein kinase C delta binding protein; Protein kinase C delta-binding protein; Sdr related gene product that binds to c kinase; Serum deprivation response factor related gene product that binds to C kinase; Serum deprivation response factor-related gene product that binds to C-kinase; SRBC
Target Background
The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein.
Notification