Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKRIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 67-134 of human PRKRIP1 (NP_078929.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PRKRIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 67-134 of human PRKRIP1 (NP_078929.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07085A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKRIP1 |
| Target Synonyms | C114; KRBOX3; PRKRIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse testis, Rat thymus, THP-1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 67-134 of human PRKRIP1 (NP_078929.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKNKIAAEEQTAKRRKKRQKL | Uniprot ID | Q9H875 |
Uniprot Id
Q9H875
Target Species
Human
Target Name
PRKRIP1
Target Full Name
PRKR-interacting protein 1
Target Function
Required for pre-mRNA splicing as component of the spliceosome. Binds double-stranded RNA. Inhibits EIF2AK2 kinase activity.
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Protein Families
PRKRIP1 family
Target Synonyms
PRKRIP1; PRKR-interacting protein 1
Target Background
Predicted to enable double-stranded RNA binding activity; protein kinase binding activity; and protein kinase inhibitor activity. Involved in renal system process. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
