-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Progastrin-releasing peptide was raised in Rabbit using the recombinant protein of human progastrin-releasing peptide as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Progastrin-releasing peptide was raised in Rabbit using the recombinant protein of human progastrin-releasing peptide as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08141A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Progastrin-releasing peptide |
| Target Synonyms | BN; GRP-10; proGRP; preproGRP; Progastrin-releasing peptide | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant protein of human progastrin-releasing peptide. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ | Uniprot ID | P07492 |
Uniprot Id
P07492
Target Species
Human
Target Name
GRP
Target Full Name
Gastrin-releasing peptide
Target Function
Stimulates the release of gastrin and other gastrointestinal hormones. Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior. Contributes primarily to nonhistaminergic itch sensation. Contributes to long-term fear memory, but not normal spatial memory. Contributes to the regulation of food intake.
Target Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle lumen.
Target Protein Families
Bombesin/neuromedin-B/ranatensin family
Target Research Area
Signal Transduction
Target Synonyms
BN; Bombesin; GRP; GRP-10; GRP_HUMAN; GRP10; Neuromedin-C; NeuromedinC; Pre progastrin releasing peptide; PreproGRP; ProGRP
Target Background
This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Notification