-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PROX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-375 of human PROX1 (NP_002754.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PROX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-375 of human PROX1 (NP_002754.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03390A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PROX1 |
| Target Synonyms | PROX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, Mouse liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-375 of human PROX1 (NP_002754.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFQQLVSARKEQKREERRQLKQQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNEMCELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAMSQVVDTVVKVFSAKP | Uniprot ID | Q92786 |
Uniprot Id
Q92786
Target Species
Human
Target Name
PROX1
Target Full Name
Prospero homeobox protein 1
Target Function
Transcription factor involved in developmental processes such as cell fate determination, gene transcriptional regulation and progenitor cell regulation in a number of organs. Plays a critical role in embryonic development and functions as a key regulatory protein in neurogenesis and the development of the heart, eye lens, liver, pancreas and the lymphatic system. Involved in the regulation of the circadian rhythm. Represses: transcription of the retinoid-related orphan receptor RORG, transcriptional activator activity of RORA and RORG and the expression of RORA/G-target genes including core clock components: ARNTL/BMAL1, NPAS2 and CRY1 and metabolic genes: AVPR1A and ELOVL3.
Target Subcellular Location
Nucleus.
Target Protein Families
Prospero homeodomain family
Target Tissue Specificity
Most actively expressed in the developing lens. Detected also in embryonic brain, lung, liver and kidney. In adult, it is more abundant in heart and liver than in brain, skeletal muscle, kidney and pancreas.
Target Synonyms
Homeobox prospero like protein; Homeobox prospero like protein PROX1; Homeobox prospero-like protein PROX1; Prospero homeobox 1; Prospero homeobox protein 1; Prospero related homeobox 1; prospero-related homeobox gene 1; PROX 1; PROX-1; PROX1; PROX1_HUMAN; zgc:111888
Target Background
The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene is conserved across vertebrates and may play an essential role during development. Altered levels of this protein have been reported in cancers of different organs, such as colon, brain, blood, breast, pancreas, liver and esophagus. Alternative splicing results in multiple transcript variants.
Notification