Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 878-1047 of human PSD3 (NP_056125.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 878-1047 of human PSD3 (NP_056125.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01658A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSD3 |
| Target Synonyms | EFA6D; EFA6R; HCA67; PSD3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 878-1047 of human PSD3 (NP_056125.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QTQSPEEMQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQKVT | Uniprot ID | Q9NYI0 |
Uniprot Id
Q9NYI0
Target Species
Human
Target Name
PSD3
Target Full Name
PH and SEC7 domain-containing protein 3
Target Function
Guanine nucleotide exchange factor for ARF6.
Target Subcellular Location
Cell membrane. Cell projection, ruffle membrane. Cell junction, synapse, postsynaptic density.
Target Tissue Specificity
Isoform 2 is expressed in epididymis (at protein level).
Target Synonyms
PSD3; EFA6D; EFA6R; HCA67; KIAA0942; PH and SEC7 domain-containing protein 3; Epididymis tissue protein Li 20mP; Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 D; Exchange factor for ARF6 D; Hepatocellular carcinoma-associated antigen 67; Pleckstrin homology and SEC7 domain-containing protein 3
Target Background
Predicted to enable guanyl-nucleotide exchange factor activity and phospholipid binding activity. Predicted to be involved in regulation of ARF protein signal transduction and regulation of catalytic activity. Predicted to be located in membrane. Predicted to be active in ruffle membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
