-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTBP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP2 (Q9UKA9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PTBP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP2 (Q9UKA9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16214A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTBP2 |
| Target Synonyms | nPTB; PTBLP; brPTB; PTBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse testis, Rat testis, RD, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP2 (Q9UKA9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLE | Uniprot ID | Q9UKA9 |
Uniprot Id
Q9UKA9
Target Species
Human
Target Name
PTBP2
Target Full Name
Polypyrimidine tract-binding protein 2
Target Function
RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. In addition to its function in pre-mRNA splicing, plays also a role in the regulation of translation.; Reduced affinity for RNA.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Mainly expressed in brain although also detected in other tissues like heart and skeletal muscle. Isoform 1 and isoform 2 are specifically expressed in neuronal tissues. Isoform 3 and isoform 4 are expressed in non-neuronal tissues. Isoform 5 and isoform
Target Synonyms
brPTB; FLJ34897; MIBP; Neural polypyrimidine tract binding protein; Neural polypyrimidine tract-binding protein; Neurally enriched homolog of PTB; Neurally-enriched homolog of PTB; nPTB 5; nPTB 6; nPTB 7; nPTB 8; nPTB; nPTB5; nPTB6; nPTB7; nPTB8; Polypyrimidine tract binding protein 2; Polypyrimidine tract-binding protein 2; PTB; PTB like; PTB like protein; PTB-like protein; PTBLP; PTBP 2; Ptbp2; PTBP2_HUMAN; Splicing regulator
Target Background
The protein encoded by this gene binds to intronic polypyrimidine clusters in pre-mRNA molecules and is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein (PTB) but most of its isoforms are expressed primarily in the brain. Alternative splicing results in multiple transcript variants.
Notification