Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTCRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 172-281 of human PTCRA (NP_612153.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTCRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 172-281 of human PTCRA (NP_612153.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02657A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTCRA |
| Target Synonyms | PTA; PT-ALPHA; PTCRA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells, HL-60, Jurkat, K-562, Raji, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 172-281 of human PTCRA (NP_612153.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA | Uniprot ID | Q6ISU1 |
Uniprot Id
Q6ISU1
Target Species
Human
Target Name
PTCRA
Target Full Name
Pre T-cell antigen receptor alpha
Target Function
The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow.
Target Synonyms
PTCRA; Pre T-cell antigen receptor alpha; pT-alpha; pTa; pT-alpha-TCR
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
