-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTP4A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human PTP4A3 (NP_009010.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PTP4A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human PTP4A3 (NP_009010.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09918A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTP4A3 |
| Target Synonyms | PRL3; PRL-3; PRL-R; PTP4A3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human PTP4A3 (NP_009010.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM | Uniprot ID | O75365 |
Uniprot Id
O75365
Target Species
Human
Target Name
PTP4A3
Target Full Name
Protein tyrosine phosphatase type IVA 3
Target Function
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II.
Target Subcellular Location
Cell membrane. Early endosome.
Target Protein Families
Protein-tyrosine phosphatase family
Target Tissue Specificity
Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis.
Target Synonyms
Potentially prenylated protein tyrosine phosphatase; PRL 3; PRL R; PRL-3; PRL-R; PRL3; PRLR; Protein tyrosine phosphatase 4a3; Protein tyrosine phosphatase type IVA 3; Protein-tyrosine phosphatase 4a3; Protein-tyrosine phosphatase of regenerating liver 3; PTP 4A3; PTP4A3; TP4A3_HUMAN
Target Background
This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants.
Notification