-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PVRL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-517 of human PVRL1 (NP_002846.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PVRL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-517 of human PVRL1 (NP_002846.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00529A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PVRL1 |
| Target Synonyms | ED4; PRR; HIgR; HV1S; HVEC; OFC7; PRR1; PVRR; CD111; PVRL1; PVRR1; SK-12; CLPED1; nectin-1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HepG2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 450-517 of human PVRL1 (NP_002846.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV | Uniprot ID | Q15223 |
Uniprot Id
Q15223
Target Species
Human
Target Name
NECTIN1
Target Full Name
Nectin-1
Target Function
Promotes cell-cell contacts by forming homophilic or heterophilic trans-dimers. Heterophilic interactions have been detected between NECTIN1 and NECTIN3 and between NECTIN1 and NECTIN4. Has some neurite outgrowth-promoting activity.; (Microbial infection) Acts as a receptor for herpes simplex virus 1/HHV-1, herpes simplex virus 2/HHV-2, and pseudorabies virus/PRV.
Target Involvement
Ectodermal dysplasia, Margarita Island type (EDMI); Non-syndromic orofacial cleft 7 (OFC7)
Target Subcellular Location
[Isoform Alpha]: Cell membrane; Single-pass type I membrane protein. Cell junction, synapse, presynaptic cell membrane.; [Isoform Delta]: Cell membrane; Single-pass type I membrane protein.; [Isoform Gamma]: Secreted.
Target Protein Families
Nectin family
Target Synonyms
CD111; CD111 antigen; CLPED1; ectodermal dysplasia 4 (Margarita Island type); ED4; Herpes virus entry mediator C; Herpesvirus entry mediator C; Herpesvirus Ig like receptor; Herpesvirus Ig-like receptor; HIgR; HveC; MGC142031; Nectin 1; Nectin-1; OFC7; OROFACIAL CLEFT 7; OTTHUMP00000232093; OTTHUMP00000232094; OTTHUMP00000232095; Poliovirus receptor related protein 1; poliovirus receptor-like 1; Poliovirus receptor-related protein 1; PRR; PRR1; PVRL 1; PVRL1; PVRL1_HUMAN; PVRR; PVRR1; SK-12
Target Background
This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain (in some isoforms), and a cytoplasmic region. This protein acts as a receptor for glycoprotein D (gD) of herpes simplex viruses 1 and 2 (HSV-1, HSV-2), and pseudorabies virus (PRV) and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome (CLPED1) as well as non-syndromic cleft lip with or without cleft palate (CL/P). Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
Notification