-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against R9AP/RGS9BP was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-107 of human R9AP/RGS9BP(NP_997274.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against R9AP/RGS9BP was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-107 of human R9AP/RGS9BP(NP_997274.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08009A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | R9AP/RGS9BP |
| Target Synonyms | R9AP; RGS9; PERRS; R9AP/RGS9BP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T cells transfected with R9AP/RGS9BP | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1-107 of human R9AP/RGS9BP(NP_997274.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEADMRRALELGAAFPLHA | Uniprot ID | Q6ZS82 |
Uniprot Id
Q6ZS82
Target Species
Human
Target Name
RGS9BP
Target Full Name
Regulator of G-protein signaling 9-binding protein
Target Function
Regulator of G protein-coupled receptor (GPCR) signaling in phototransduction. Participates in the recovery phase of visual transduction via its interaction with RGS9-1 isoform. Acts as a membrane-anchor that mediates the targeting of RGS9-1 to the photoreceptor outer segment, where phototransduction takes place. Enhances the ability of RGS9-1 to stimulate G protein GTPase activity, allowing the visual signal to be terminated on the physiologically time scale. It also controls the proteolytic stability of RGS9-1, probably by protecting it from degradation.
Target Involvement
Prolonged electroretinal response suppression (PERRS)
Target Subcellular Location
Membrane; Single-pass type IV membrane protein.
Target Protein Families
RGS7BP/RGS9BP family
Target Synonyms
RGS9BP; R9AP; Regulator of G-protein signaling 9-binding protein; RGS9-anchoring protein
Target Background
The protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. This protein is associated with a heterotetrameric complex, specifically interacting with the regulator of G-protein signaling 9, and appears to function as the membrane anchor for the other largely soluble interacting partners. Mutations in this gene are associated with prolonged electroretinal response suppression (PERRS), also known as bradyopsia.
Notification