-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 39-140 of human RAB14 (NP_057406.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 39-140 of human RAB14 (NP_057406.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09544A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB14 |
| Target Synonyms | FBP; RAB-14; RAB14 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Neuro-2a | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 39-140 of human RAB14 (NP_057406.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK | Uniprot ID | P61106 |
Uniprot Id
P61106
Target Species
Human
Target Name
RAB14
Target Full Name
Ras-related protein Rab-14
Target Function
Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes. Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion.
Target Subcellular Location
Recycling endosome. Early endosome membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
bA165P4.3; F protein binding protein 1; FBP; GTPase Rab14; RAB 14; RAB14; RAB14 member RAS oncogene family; RAB14_HUMAN; Ras related protein Rab 14; Ras-related protein Rab-14; RP11 165P4.4; Small GTP binding protein RAB14
Target Background
RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).
Notification