-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-192 of human RAC2 (NP_002863.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RAC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-192 of human RAC2 (NP_002863.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10959A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAC2 |
| Target Synonyms | Gx; EN-7; IMD73A; IMD73B; IMD73C; HSPC022; p21-Rac2; RAC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen, Rat thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-192 of human RAC2 (NP_002863.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL | Uniprot ID | P15153 |
Uniprot Id
P15153
Target Species
Human
Target Name
RAC2
Target Full Name
Ras-related C3 botulinum toxin substrate 2
Target Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.
Target Involvement
Neutrophil immunodeficiency syndrome (NEUID)
Target Subcellular Location
Cytoplasm. Note=Membrane-associated when activated.
Target Protein Families
Small GTPase superfamily, Rho family
Target Tissue Specificity
Hematopoietic specific.
Target Synonyms
EN 7; EN-7; EN7; GX; HSPC 022; HSPC022; p21 Rac 2; p21 Rac2; p21-Rac2; p21Rac2; RAC 2; Rac2; RAC2_HUMAN; Ras related C3 botulinum toxin substrate 2 (rho family; small GTP binding protein Rac2; Ras related C3 botulinum toxin substrate 2; Ras related C3 botulinum toxin substrate 3 (rho family; small GTP binding protein Rac2); Ras related C3 botulinum toxin substrate 3; Ras-related C3 botulinum toxin substrate 2; Rho family small GTP binding protein Rac 2; Rho family small GTP binding protein Rac2; Small G protein
Target Background
This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6.
Notification