-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RACK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1 (P63244) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RACK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1 (P63244) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16175A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RACK1 |
| Target Synonyms | H12.3; HLC-7; PIG21; GNB2L1; Gnb2-rs1; RACK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, HepG2, Jurkat, Mouse brain, Mouse spleen, Rat kidney, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1 (P63244). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW | Uniprot ID | P63244 |
Uniprot Id
P63244
Target Species
Human
Target Name
RACK1
Target Full Name
Small ribosomal subunit protein RACK1
Target Function
Scaffolding protein involved in the recruitment, assembly and/or regulation of a variety of signaling molecules. Interacts with a wide variety of proteins and plays a role in many cellular processes. Component of the 40S ribosomal subunit involved in translational repression. Involved in the initiation of the ribosome quality control (RQC), a pathway that takes place when a ribosome has stalled during translation, by promoting ubiquitination of a subset of 40S ribosomal subunits. Binds to and stabilizes activated protein kinase C (PKC), increasing PKC-mediated phosphorylation. May recruit activated PKC to the ribosome, leading to phosphorylation of EIF6. Inhibits the activity of SRC kinases including SRC, LCK and YES1. Inhibits cell growth by prolonging the G0/G1 phase of the cell cycle. Enhances phosphorylation of BMAL1 by PRKCA and inhibits transcriptional activity of the BMAL1-CLOCK heterodimer. Facilitates ligand-independent nuclear translocation of AR following PKC activation, represses AR transactivation activity and is required for phosphorylation of AR by SRC. Modulates IGF1R-dependent integrin signaling and promotes cell spreading and contact with the extracellular matrix. Involved in PKC-dependent translocation of ADAM12 to the cell membrane. Promotes the ubiquitination and proteasome-mediated degradation of proteins such as CLEC1B and HIF1A. Required for VANGL2 membrane localization, inhibits Wnt signaling, and regulates cellular polarization and oriented cell division during gastrulation. Required for PTK2/FAK1 phosphorylation and dephosphorylation. Regulates internalization of the muscarinic receptor CHRM2. Promotes apoptosis by increasing oligomerization of BAX and disrupting the interaction of BAX with the anti-apoptotic factor BCL2L. Inhibits TRPM6 channel activity. Regulates cell surface expression of some GPCRs such as TBXA2R. Plays a role in regulation of FLT1-mediated cell migration. Involved in the transport of ABCB4 from the Golgi to the apical bile canalicular membrane. Promotes migration of breast carcinoma cells by binding to and activating RHOA.; (Microbial infection) Binds to Y.pseudotuberculosis yopK which leads to inhibition of phagocytosis and survival of bacteria following infection of host cells.; (Microbial infection) Enhances phosphorylation of HIV-1 Nef by PKCs.; (Microbial infection) In case of poxvirus infection, remodels the ribosomes so that they become optimal for the viral mRNAs (containing poly-A leaders) translation but not for host mRNAs.; (Microbial infection) Contributes to the cap-independent internal ribosome entry site (IRES)-mediated translation by some RNA viruses.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm. Cytoplasm, perinuclear region. Nucleus. Perikaryon. Cell projection, dendrite. Cell projection, phagocytic cup.
Target Protein Families
WD repeat G protein beta family, Ribosomal protein RACK1 subfamily
Target Tissue Specificity
In the liver, expressed at higher levels in activated hepatic stellate cells than in hepatocytes or Kupffer cells. Up-regulated in hepatocellular carcinomas and in the adjacent non-tumor liver tissue.
Target Synonyms
Cell proliferation-inducing gene 21 protein; GBLP_HUMAN; Gnb2-rs1; Gnb2l1; Guanine nucleotide binding protein (G protein) beta polypeptide 2 like 1; Guanine nucleotide binding protein beta polypeptide 2 like 1; Guanine nucleotide binding protein beta subunit 2 like 1; Guanine nucleotide binding protein beta subunit like protein 12.3; Guanine nucleotide binding protein subunit beta 2 like 1; Guanine nucleotide binding protein subunit beta like protein 12.3; Guanine nucleotide-binding protein subunit beta-2-like 1; Guanine nucleotide-binding protein subunit beta-like protein 12.3; H12.3; HLC-7; Human lung cancer oncogene 7 protein; lung cancer oncogene 7; OTTHUMP00000223704; OTTHUMP00000223870; OTTHUMP00000223891; OTTHUMP00000223893; OTTHUMP00000223900; OTTHUMP00000223902; OTTHUMP00000223930; OTTHUMP00000223931; PIG21; Proliferation inducing gene 21; Protein homologous to chicken B complex protein guanine nucleotide binding; RACK1; Receptor for activated C kinase 1; Receptor for activated C kinase; Receptor of activated protein kinase C 1
Target Background
Enables several functions, including cyclin binding activity; enzyme binding activity; and protein domain specific binding activity. Involved in several processes, including positive regulation of hydrolase activity; regulation of cellular protein metabolic process; and regulation of signal transduction. Located in several cellular components, including midbody; perinuclear region of cytoplasm; and phagocytic cup. Part of IRE1-RACK1-PP2A complex.
Notification