-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rad23A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Rad23A (P54725) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Rad23A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Rad23A (P54725) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15817A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD23A |
| Target Synonyms | HR23A; HHR23A; Rad23A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Rat testis, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Rad23A (P54725). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE | Uniprot ID | P54725 |
Uniprot Id
P54725
Target Species
Human
Target Name
RAD23A
Target Full Name
UV excision repair protein RAD23 homolog A
Target Function
Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.; Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize XPC.; (Microbial infection) Involved in Vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 Vpr with the host proteasome.
Target Subcellular Location
Nucleus.
Target Protein Families
RAD23 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
hHR 23A; hHR23A; HR23A; MGC111083; RAD 23a; RAD23 homolog A (S. cerevisiae); RAD23 homolog A; RAD23 yeast homolog A; RAD23A; RD23A_HUMAN; UV excision repair protein RAD23; UV excision repair protein RAD23 homolog A
Target Background
The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair. Proteins in this family have a modular domain structure consisting of an ubiquitin-like domain (UbL), ubiquitin-associated domain 1 (UbA1), XPC-binding domain and UbA2. The protein encoded by this gene plays an important role in nucleotide excision repair and also in delivery of polyubiquitinated proteins to the proteasome. Alternative splicing results in multiple transcript variants encoding multiple isoforms.
Notification