-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rad51 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.
The antibody against Rad51 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.
| Cat.No | ADA-16028A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD51 |
| Target Synonyms | RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930; Rad51 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse testis, Rat testis | Application | ELISA, WB, ChIP, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII | Uniprot ID | Q06609 |
Uniprot Id
Q06609
Target Species
Human
Target Name
RAD51
Target Full Name
DNA repair protein RAD51 homolog 1
Target Function
Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR). Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. Also involved in interstrand cross-link repair.
Target Involvement
Breast cancer (BC); Mirror movements 2 (MRMV2); Fanconi anemia, complementation group R (FANCR)
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Mitochondrion matrix. Chromosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
RecA family, RAD51 subfamily
Target Tissue Specificity
Highly expressed in testis and thymus, followed by small intestine, placenta, colon, pancreas and ovary. Weakly expressed in breast.
Target Synonyms
BRCA1/BRCA2 containing complex; subunit 5; BRCC 5; BRCC5; DNA repair protein RAD51 homolog 1; DNA repair protein rhp51; FANCR; hRAD51; HsRAD51; HsT16930; MRMV2; Rad 51; RAD51; RAD51 homolog (RecA homolog; E. coli) (S. cerevisiae); RAD51 homolog A; RAD51 homolog; RAD51 recombinase; RAD51; S. cerevisiae; homolog of; RAD51_HUMAN; RAD51A; RECA ; RecA like protein; RecA; E. coli; homolog of; Recombination protein A
Target Background
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification