Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RALGDS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 771-902 of human RALGDS (NP_001258705) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RALGDS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 771-902 of human RALGDS (NP_001258705) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10538A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RALGDS |
| Target Synonyms | RGF; RGDS; RalGEF; RALGDS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse ovary, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 771-902 of human RALGDS (NP_001258705). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF | Uniprot ID | Q12967 |
Uniprot Id
Q12967
Target Species
Human
Target Name
RALGDS
Target Full Name
Ral guanine nucleotide dissociation stimulator
Target Function
Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Synonyms
RALGDS; KIAA1308; RGFRal guanine nucleotide dissociation stimulator; RalGDS; Ral guanine nucleotide exchange factor; RalGEF
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
