Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RASSF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human RASSF4 (NP_114412.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RASSF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human RASSF4 (NP_114412.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05356A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RASSF4 |
| Target Synonyms | AD037; RASSF4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A431, Mouse spleen, Raji, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human RASSF4 (NP_114412.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQ | Uniprot ID | Q9H2L5 |
Uniprot Id
Q9H2L5
Target Species
Human
Target Name
RASSF4
Target Full Name
Ras association domain-containing protein 4
Target Function
Potential tumor suppressor. May act as a KRAS effector protein. May promote apoptosis and cell cycle arrest.
Target Tissue Specificity
Widely expressed. Frequently down-regulated in tumor cell lines.
Target Synonyms
3830411C14Rik; AD037; AI586137; MGC105606; MGC44914; OTTHUMP00000019493; Ras association (RalGDS/AF 6) domain family 4; Ras association (RalGDS/AF 6) domain family member 4; Ras association domain containing protein 4; Ras association domain family 4; Ras association domain-containing protein 4; RASF4_HUMAN; RASSF 4; Rassf4; RP11-285G1.4; Tumor suppressor RASSF4
Target Background
The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
