-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBL1 (NP_002886.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBL1 (NP_002886.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07435A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBL1 |
| Target Synonyms | PRB1; p107; CP107; RBL1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBL1 (NP_002886.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYH | Uniprot ID | P28749 |
Uniprot Id
P28749
Target Species
Human
Target Name
RBL1
Target Full Name
Retinoblastoma-like protein 1
Target Function
Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation. May act as a tumor suppressor.
Target Subcellular Location
Nucleus.
Target Protein Families
Retinoblastoma protein (RB) family
Target Synonyms
107 kDa retinoblastoma-associated protein; Cellular protein 107; Cellular protein p107; CP107; MGC40006; p107; PRB1; RBL1; RBL1_HUMAN; Retinoblastoma like protein 1; retinoblastoma-like 1 (p107); Retinoblastoma-like protein 1
Target Background
The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene.
Notification