Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP2 (NP_004155.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP2 (NP_004155.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02877A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBP2 |
| Target Synonyms | CRBP2; RBPC2; CRBPII; CRABP-II; RBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP2 (NP_004155.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK | Uniprot ID | P50120 |
Uniprot Id
P50120
Target Species
Human
Target Name
RBP2
Target Full Name
Retinol-binding protein 2
Target Function
Intracellular transport of retinol.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Higher expression in adult small intestine and to a much lesser extent in fetal kidney.
Target Research Area
Signal Transduction
Target Synonyms
Cellular retinol binding protein II; Cellular retinol-binding protein II; CRABP II; Crbp 2; CRBP II; CRBP-II; CRBP2; CrbpII; MGC159254; MGC159256; Rbp 2; Rbp2; RBPC2; RET2_HUMAN; Retinol binding protein 2; Retinol binding protein 2 cellular; Retinol-binding protein 2
Target Background
This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
