Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human RBP4 (P02753) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RBP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human RBP4 (P02753) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14432A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBP4 |
| Target Synonyms | RDCCAS; MCOPCB10; RBP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RBP4 (P02753). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL | Uniprot ID | P02753 |
Uniprot Id
P02753
Target Species
Human
Target Name
RBP4
Target Full Name
Retinol-binding protein 4
Target Function
Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Target Involvement
Retinal dystrophy, iris coloboma, and comedogenic acne syndrome (RDCCAS); Microphthalmia, isolated, with coloboma, 10 (MCOPCB10)
Target Subcellular Location
Secreted.
Target Protein Families
Calycin superfamily, Lipocalin family
Target Tissue Specificity
Detected in blood plasma and in urine (at protein level).
Target Synonyms
RDCCAS; MCOPCB10; RBP4
Target Background
This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
