-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RCHY1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human RCHY1 (Q96PM5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RCHY1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human RCHY1 (Q96PM5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14347A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RCHY1 |
| Target Synonyms | ZCHY; ARNIP; CHIMP; PIRH2; RNF199; ZNF363; PRO1996; RCHY1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human RCHY1 (Q96PM5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ | Uniprot ID | Q96PM5 |
Uniprot Id
Q96PM5
Target Species
Human
Target Name
RCHY1
Target Full Name
RING finger and CHY zinc finger domain-containing protein 1
Target Function
Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, P73, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Monoubiquitinates the translesion DNA polymerase POLH. Contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity.
Target Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm.
Target Research Area
Cell Biology
Target Synonyms
Androgen receptor N terminal interacting protein; Androgen receptor N-terminal-interacting protein; ARNIP; CH-rich-interacting match with PLAG1; CHIMP; E3 ubiquitin-protein ligase Pirh2; hARNIP; hPirh2; p53 induced protein with a RING H2 domain; p53-induced RING-H2 protein; PIRH2E; PIRH2F; PRO1996; RCHY1; Ring finger and CHY zinc finger domain containing 1 E3 ubiquitin protein ligase; RING finger and CHY zinc finger domain-containing protein 1; RING finger protein 199; RNF199; ZCHY; ZFP 363; zinc finger CHY type; Zinc finger protein 363; ZN363_HUMAN; ZNF363
Target Background
The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification