-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against REG1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human REG1A (NP_002900.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against REG1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human REG1A (NP_002900.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00433A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | REG1A |
| Target Synonyms | P19; PSP; PTP; REG; ICRF; PSPS; PSPS1; REG1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, K-562, Mouse intestine, Mouse lung, SW480 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human REG1A (NP_002900.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWK | Uniprot ID | P05451 |
Uniprot Id
P05451
Target Species
Human
Target Name
REG1A
Target Full Name
Lithostathine-1-alpha
Target Function
Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
Target Subcellular Location
Secreted.
Target Tissue Specificity
In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients.
Target Synonyms
ICRF; Islet cells regeneration factor; Islet of Langerhans regenerating protein; Lithostathine 1 alpha ; Lithostathine 1 alpha precursor; Lithostathine; Lithostathine-1-alpha; MGC12447 ; P19 ; Pancreatic stone protein; Pancreatic stone protein secretory; Pancreatic thread protein; Protein X; PSP; PSPS ; PSPS1 ; PTP; RATRGPI; REG; REG-1-alpha; Reg1; REG1A; REG1A_HUMAN; Regenerating islet derived 1 alpha; Regenerating islet derived 1 alpha pancreatic stone protein pancreatic thread protein; Regenerating islet-derived protein 1-alpha; Regenerating protein I alpha
Target Background
This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication.
Notification