-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RFC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-363 of human RFC4 (NP_002907.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against RFC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-363 of human RFC4 (NP_002907.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-11198A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RFC4 |
| Target Synonyms | A1; RFC37; RFC4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HepG2, K-562, MCF7, SW480, SW620 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 204-363 of human RFC4 (NP_002907.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC | Uniprot ID | P35249 |
Uniprot Id
P35249
Target Species
Human
Target Name
RFC4
Target Full Name
Replication factor C subunit 4
Target Function
The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.
Target Subcellular Location
Nucleus.
Target Protein Families
Activator 1 small subunits family
Target Synonyms
A1 37; A1 37 kDa subunit; Activator 1 37; Activator 1 37 kDa subunit; Activator 1 subunit 4; Replication factor C 37; Replication factor C 37 kDa subunit; Replication factor C subunit 4; Replication factor C4; RF-C 37 kDa subunit; RFC 37; RFC37; RFC4 replication factor C (activator 1)4 37kDa; RfC4; RFC4_HUMAN
Target Background
The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.
Notification