-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RMI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human RMI2 (NP_689521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RMI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human RMI2 (NP_689521.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01213A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RMI2 |
| Target Synonyms | BLAP18; C16orf75; RMI2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human RMI2 (NP_689521.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP | Uniprot ID | Q96E14 |
Uniprot Id
Q96E14
Target Species
Human
Target Name
RMI2
Target Full Name
RecQ-mediated genome instability protein 2
Target Function
Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.
Target Involvement
A homozygous deletion of RMI2 has been found in a family with a Bloom-like syndrome and is probable responsible for the phenotype. Patients manifest depigmented skin lesions, multiple cafe-au-lait macules, and growth deficiency. Cells from affected individuals show a high rate of sister chromatid exchange and increased chromosomal breaks.
Target Subcellular Location
Nucleus. Note=Colocalizes with BLM at nuclear DNA repair foci.
Target Protein Families
RMI2 family
Target Synonyms
BLAP18; BLM-associated protein of 18 kDa; C16orf75; hRMI2; MGC24665; RecQ-mediated genome instability protein 2; RMI2; RMI2_HUMAN
Target Background
RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).
Notification