Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF123 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF123 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09303A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF123 |
| Target Synonyms | KPC1; FP1477; RNF123 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse brain, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA | Uniprot ID | Q5XPI4 |
Uniprot Id
Q5XPI4
Target Species
Human
Target Name
RNF123
Target Full Name
E3 ubiquitin-protein ligase RNF123
Target Function
Catalytic subunit of the KPC complex that acts as E3 ubiquitin-protein ligase. Promotes the ubiquitination and proteasome-mediated degradation of CDKN1B which is the cyclin-dependent kinase inhibitor at the G0-G1 transition of the cell cycle. Functions also as an inhibitor of innate antiviral signaling mediated by DDX58 and IFIH1 independently of its E3 ligase activity. Interacts with the N-terminal CARD domains of DDX58 and IFIH1 and competes with the downstream adapter MAVS.
Target Subcellular Location
Cytoplasm.
Target Synonyms
DKFZp686C2222; E3 ubiquitin protein ligase RNF123; E3 ubiquitin-protein ligase RNF123; FLJ12565; FP1477; Kip1 ubiquitination promoting complex protein 1; Kip1 ubiquitination-promoting complex protein 1; KPC 1; KPC1; MGC163504; RING finger protein 123; RN123_HUMAN; RNF 123; Rnf123; Ubiquitin ligase
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
