Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF144A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-179 of human RNF144A (NP_055561.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF144A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 52-179 of human RNF144A (NP_055561.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06960A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF144A |
| Target Synonyms | UIP4; hUIP4; RNF144; UBCE7IP4; RNF144A | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-431 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 52-179 of human RNF144A (NP_055561.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD | Uniprot ID | P50876 |
Uniprot Id
P50876
Target Species
Human
Target Name
RNF144A
Target Full Name
E3 ubiquitin-protein ligase RNF144A
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates the ubiquitination and degradation of the DNA damage kinase PRKDC.
Target Subcellular Location
Cell membrane; Single-pass membrane protein. Cytoplasmic vesicle membrane.
Target Protein Families
RBR family, RNF144 subfamily
Target Synonyms
RNF144A; KIAA0161; RNF144; UBCE7IP4; E3 ubiquitin-protein ligase RNF144A; RING finger protein 144A; UbcM4-interacting protein 4; Ubiquitin-conjugating enzyme 7-interacting protein 4
Target Background
This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
