-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ROBO3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ROBO3 (NP_071765.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ROBO3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ROBO3 (NP_071765.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05370A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ROBO3 |
| Target Synonyms | HGPS; RIG1; HGPPS; RBIG1; HGPPS1; ROBO3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, SGC-7901, SP2/0 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ROBO3 (NP_071765.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPEDAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPSGALFFPRIVHGRRARPDEGVYTCVARN | Uniprot ID | Q96MS0 |
Uniprot Id
Q96MS0
Target Species
Human
Target Name
ROBO3
Target Full Name
Roundabout homolog 3
Target Function
Thought to be involved during neural development in axonal navigation at the ventral midline of the neural tube. In spinal chord development plays a role in guiding commissural axons probably by preventing premature sensitivity to Slit proteins thus inhibiting Slit signaling through ROBO1. Required for hindbrain axon midline crossing.
Target Involvement
Gaze palsy, familial horizontal, with progressive scoliosis, 1 (HGPPS1)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, ROBO family
Target Synonyms
FLJ21044; HGPPS; HGPS; RB inhibiting gene 1; Rbig 1; Rbig1; Retinoblastoma inhibiting gene 1; Rig 1; Rig1; Robo 3; Robo3; Robo3 protein; ROBO3_HUMAN; Roundabout axon guidance receptor homolog 3; Roundabout homolog 3; Roundabout like protein 3; Roundabout, axon guidance receptor, homolog 3 (Drosophila); Roundabout-like protein 3
Target Background
This gene is a member of the Roundabout (ROBO) gene family that controls neurite outgrowth, growth cone guidance, and axon fasciculation. ROBO proteins are a subfamily of the immunoglobulin transmembrane receptor superfamily. SLIT proteins 1-3, a family of secreted chemorepellants, are ligands for ROBO proteins and SLIT/ROBO interactions regulate myogenesis, leukocyte migration, kidney morphogenesis, angiogenesis, and vasculogenesis in addition to neurogenesis. This gene, ROBO3, has a putative extracellular domain with five immunoglobulin (Ig)-like loops and three fibronectin (Fn) type III motifs, a transmembrane segment, and a cytoplasmic tail with three conserved signaling motifs: CC0, CC2, and CC3 (CC for conserved cytoplasmic). Unlike other ROBO family members, ROBO3 lacks motif CC1. The ROBO3 gene regulates axonal navigation at the ventral midline of the neural tube. In mouse, loss of Robo3 results in a complete failure of commissural axons to cross the midline throughout the spinal cord and the hindbrain. Mutations ROBO3 result in horizontal gaze palsy with progressive scoliosis (HGPPS); an autosomal recessive disorder characterized by congenital absence of horizontal gaze, progressive scoliosis, and failure of the corticospinal and somatosensory axon tracts to cross the midline in the medulla.
Notification