-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ROCK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human ROCK1 (Q13464) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ROCK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human ROCK1 (Q13464) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16862A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ROCK1 |
| Target Synonyms | ROCK-I; P160ROCK; ROCK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Hep G2, HT-29, Jurkat, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human ROCK1 (Q13464). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY | Uniprot ID | Q13464 |
Uniprot Id
Q13464
Target Species
Human
Target Name
ROCK1
Target Full Name
Rho-associated protein kinase 1
Target Function
Protein kinase which is a key regulator of the actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1 and PPP1R12A. Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing. Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress. Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Required for centrosome positioning and centrosome-dependent exit from mitosis. Plays a role in terminal erythroid differentiation. Inhibits podocyte motility via regulation of actin cytoskeletal dynamics and phosphorylation of CFL1. Promotes keratinocyte terminal differentiation. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Golgi apparatus membrane; Peripheral membrane protein. Cell projection, bleb. Cytoplasm, cytoskeleton. Cell membrane. Cell projection, lamellipodium. Cell projection, ruffle.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family
Target Tissue Specificity
Detected in blood platelets.
Target Synonyms
coiled-coil-containing protein kinase 1; coiled-coil-containing protein kinase I; MGC131603; MGC43611; p160 Rhoassociated coiled coil-forming protein kinase; p160 ROCK-1; p160 ROCK1; p160ROCK; PRO0435; Renal carcinoma antigen NY REN 35; Renal carcinoma antigen NY-REN-35; Rho associated coiled coil containing protein kinase 1; Rho associated protein kinase 1; Rho kinase; Rho-alpha kinase; Rho-associated; Rho-associated protein kinase 1; ROCK I; ROCK-I; ROCK1; ROCK1_HUMAN; Rok; rokalpha
Target Background
This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. A pseudogene, related to this gene, is also located on chromosome 18.
Notification