-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL10A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RPL10A (NP_009035.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RPL10A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RPL10A (NP_009035.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03623A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL10A |
| Target Synonyms | uL1; L10A; CSA19; NEDD6; Csa-19; RPL10A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Rat spleen, Rat uterus, SKOV3, U-937 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RPL10A (NP_009035.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAF | Uniprot ID | P62906 |
Uniprot Id
P62906
Target Species
Human
Target Name
RPL10A
Target Full Name
Large ribosomal subunit protein uL1
Target Function
Component of the large ribosomal subunit.
Target Protein Families
Universal ribosomal protein uL1 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
60S ribosomal protein L10a; CSA 19; CSA-19; CSA19; L10A; NEDD 6; NEDD-6; NEDD6; neural precursor cell expressed developmentally down regulated protein 6; Neural precursor cell expressed developmentally down-regulated protein 6; Protein NEDD6; Ribosomal protein L10a; RL10A_HUMAN; rpl10a
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. The expression of this gene is downregulated in the thymus by cyclosporin-A (CsA), an immunosuppressive drug. Studies in mice have shown that the expression of the ribosomal protein L10a gene is downregulated in neural precursor cells during development. This gene previously was referred to as NEDD6 (neural precursor cell expressed, developmentally downregulated 6), but it has been renamed RPL10A (ribosomal protein 10a). As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Notification