Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPP25L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human RPP25L (NP_680544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPP25L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human RPP25L (NP_680544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse thymus, using RPP25L Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.
| Cat.No | ADA-00873A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPP25L |
| Target Synonyms | C9orf23; bA296L22.5; RPP25L | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human RPP25L (NP_680544.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS | Uniprot ID | Q8N5L8 |
Uniprot Id
Q8N5L8
Target Species
Human
Target Name
RPP25L
Target Full Name
Ribonuclease P protein subunit p25-like protein
Target Function
May be a component of ribonuclease P or MRP.
Target Subcellular Location
Nucleus.
Target Protein Families
Histone-like Alba family
Target Research Area
Cell Biology
Target Synonyms
RPP25L; C9orf23; Ribonuclease P protein subunit p25-like protein; RNase P protein subunit-like p25; Rpp25-like protein
Target Background
This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
