Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPS8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human RPS8 (NP_001003.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RPS8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human RPS8 (NP_001003.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11578A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPS8 |
| Target Synonyms | S8; eS8; RPS8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse ovary, Mouse pancreas, Rat pancreas, SGC-7901 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human RPS8 (NP_001003.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNC | Uniprot ID | P62241 |
Uniprot Id
P62241
Target Species
Human
Target Name
RPS8
Target Full Name
Small ribosomal subunit protein eS8
Target Subcellular Location
Cytoplasm. Membrane; Lipid-anchor. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Target Protein Families
Eukaryotic ribosomal protein eS8 family
Target Synonyms
40S ribosomal protein S8; OK/SW-cl.83; OTTHUMP00000010160; OTTHUMP00000010161; Ribosomal protein S8; RPS8; RS8_HUMAN; S8
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8E family of ribosomal proteins. It is located in the cytoplasm. Increased expression of this gene in colorectal tumors and colon polyps compared to matched normal colonic mucosa has been observed. This gene is co-transcribed with the small nucleolar RNA genes U38A, U38B, U39, and U40, which are located in its fourth, fifth, first, and second introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
