-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RUVBL1/TIP49A/PONTIN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-456 of human RUVBL1/TIP49A/PONTIN (Q9Y265) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA.
The antibody against RUVBL1/TIP49A/PONTIN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-456 of human RUVBL1/TIP49A/PONTIN (Q9Y265) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA.
| Cat.No | ADA-13964A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RUVBL1/TIP49A/PONTIN |
| Target Synonyms | RVB1; TIH1; ECP54; TIP49; ECP-54; INO80H; NMP238; PONTIN; TIP49A; NMP 238; Pontin52; RUVBL1/TIP49A/PONTIN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-431, HT-1080, Mouse brain, Mouse spleen, U-2 OS | Application | ELISA, WB, ChIP, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-456 of human RUVBL1/TIP49A/PONTIN (Q9Y265). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK | Uniprot ID | Q9Y265 |
Uniprot Id
Q9Y265
Target Species
Human
Target Name
RUVBL1
Target Full Name
RuvB-like 1
Target Function
Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (3' to 5') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome. Proposed core component of the chromatin remodeling INO80 complex which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding. Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. Essential for cell proliferation. May be able to bind plasminogen at cell surface and enhance plasminogen activation.
Target Subcellular Location
Nucleus matrix. Nucleus, nucleoplasm. Cytoplasm. Membrane. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Dynein axonemal particle. Note=Mainly localized in the nucleus, associated with nuclear matrix or in the nuclear cytosol, although it is also present in the cytoplasm and associated with the cell membranes. In prophase and prometaphase it is located at the centrosome and the branching microtubule spindles. After mitotic nuclear membrane disintigration it accumulates at the centrosome and sites of tubulin polymerization. As cells pass through metaphase and into telophase it is located close to the centrosome at the early phase of tubulin polymerization. In anaphase it accumulates at the zone of tubule interdigitation. In telophase it is found at polar tubule overlap, and it reappears at the site of chromosomal decondensation in the daughter cells.
Target Protein Families
RuvB family
Target Tissue Specificity
Ubiquitously expressed with high expression in heart, skeletal muscle and testis.
Target Synonyms
49 kDa TATA box binding protein interacting protein; 49 kDa TATA box-binding protein-interacting protein; 49 kDa TBP interacting protein; 49 kDa TBP-interacting protein; 54 kDa erythrocyte cytosolic protein; ECP-54; ECP54; ERYTHROCYTE CYTOSOLIC PROTEIN, 54-KD; INO80 complex subunit H; NMP 238; Nuclear matrix protein 238; Pontin 52; PONTIN; RuvB like 1; RuvB like AAA ATPase 1; RuvB-like 1; RUVB1_HUMAN; RUVBL1; RVB1; TAP54 alpha ; TAP54-alpha; TIP49; TIP49a; TIP60 associated protein 54 alpha; TIP60-associated protein 54-alpha
Target Background
This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants.
Notification